Rpsa Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Rpsa antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	ribosomal protein SA
Database Link	NP_035159 Entrez Gene 16785 Mouse UniProt ID P14206
Background	Rpsa is required for the assembly and/or stability of the 40S ribosomal subunit. It is also required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. It slso functions as a cell surface receptor for laminin. It plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. It may play a role in cell fate determination and tissue morphogenesis. It also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria. It enables malignant tumor cells to penetrate laminin tissue and vessel barriers and activates precursor thymic anti-OFA/iLRP specific cytotoxic T cell. It may induce CD8 T-suppressor cells secreting IL-10.
Synonyms	37LRP; 67LR; LAMBR; LamR; LAMR1; LBP; LBP/p40; LRP; LRP/LR; NEM/1CHD4; p40
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.