TMEM184A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM184A antibody: synthetic peptide directed towards the C terminal of human TMEM184A. Synthetic peptide located within the following region: CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	transmembrane protein 184A
Database Link	NP_001091089 Entrez Gene 202915 Human UniProt ID Q6ZMB5
Background	TMEM184A is a multi-pass membrane proteinPotential. It belongs to the UPF0206 family. The exact function of TMEM184A remains unknown.
Synonyms	SDMG1
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Horse: 79%; Mouse: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.