NALP1 (NLRP1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NLRP1 antibody: synthetic peptide directed towards the N terminal of human NLRP1. Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	155 kDa
Gene Name	NLR family, pyrin domain containing 1
Database Link	NP_001028225 Entrez Gene 22861 Human UniProt ID Q9C000
Background	This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like motif, which is possibly involved in protein-protein interactions. This protein interacts strongly with caspase 2 and weakly with caspase 9. Overexpression of this gene was demonstrated to induce apoptosis in cells. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008]
Synonyms	CARD7; CIDED; CLR17.1; DEFCAP; DEFCAP-L; NAC; NALP1; PP1044; S; SLEV1; VAMAS1
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 93%; Dog: 86%; Pig: 86%; Horse: 85%; Bovine: 85%; Rabbit: 85%; Guinea pig: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	NOD-like receptor signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.