C6ORF173 (CENPW) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CENPW antibody: synthetic peptide directed towards the N terminal of human CENPW. Synthetic peptide located within the following region: ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	10 kDa
Gene Name	centromere protein W
Database Link	NP_001012525 Entrez Gene 387103 Human UniProt ID Q5EE01
Background	CENPW is up-regulated in many cancer tissues. It suggests that CENPW may act as an oncogene.
Synonyms	C6orf173; CENP-W; CUG2
Note	Immunogen Sequence Homology: Human: 100%; Horse: 79%; Pig: 77%; Guinea pig: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.