ANKRD58 (SOWAHD) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SOWAHD antibody is: synthetic peptide directed towards the C-terminal region of Human SOWAHD. Synthetic peptide located within the following region: NLNNNSSGTTAWRAASAVGATAVETSRRVAASRTKAKDTAGSRVAQMHSL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	sosondowah ankyrin repeat domain family member D
Database Link	NP_001099046 Entrez Gene 347454 Human UniProt ID A6NJG2
Background	The function of this protein remains unknown.
Synonyms	ANKRD58
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.