METRNL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-METRNL antibody is: synthetic peptide directed towards the C-terminal region of Human METRNL. Synthetic peptide located within the following region: GVRPGHGDFLFTGHMHFGEARLGCAPRFKDFQRMYRDAQERGLNPCEVGT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	meteorin, glial cell differentiation regulator-like
Database Link	NP_001004431 Entrez Gene 284207 Human UniProt ID Q641Q3
Background	The function of this protein remains unknown.
Synonyms	MGC99788
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Pig: 92%; Rat: 92%; Horse: 92%; Guinea pig: 92%; Yeast: 90%; Dog: 86%; Rabbit: 86%; Mouse: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.