Membralin (TMEM259) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C19ORF6 antibody: synthetic peptide directed towards the middle region of human C19ORF6. Synthetic peptide located within the following region: YDDILMSSVKGLAENEENKGFLRNVVSGEHYRFVSMWMARTSYLAAFAIM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	transmembrane protein 259
Database Link	NP_219488 Entrez Gene 91304 Human UniProt ID Q4ZIN3
Background	Human membralin is unique and does not share significant sequence homology with other human genes, only membralins of other species. The membralin gene contains 11 exons which encode at least two spliced variants in human cancer. The long form of membralin (membralin-1) comprises all 11 exons, encoding a protein of 620-amino acids long and the short form of membralin (membralin-3) contains all exons except for exon 10, encoding a protein of 408 amino acids. Expression of different membralin isoforms depends on tissue type. The long form, membralin-1, is expressed in ovarian and colorectal carcinomas but not in breast or pancreatic carcinomas, which express only the short splice form, membralin-3. Recent studies suggest that membralin is a novel tumor-associated marker in ovarian serous carcinomas
Synonyms	ASBABP1; C19orf6; MBRL; MEMBRALIN; R32184_3
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.