CNPase (CNP) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IP, WB
Recommend Dilution	WB, IP
Reactivity	Human, Rat, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CNP antibody: synthetic peptide directed towards the N terminal of human CNP. Synthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	2',3'-cyclic nucleotide 3' phosphodiesterase
Database Link	NP_149124 Entrez Gene 12799 MouseEntrez Gene 25275 RatEntrez Gene 1267 Human UniProt ID P09543
Background	2',3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm
Synonyms	CNP1
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Sheep: 100%; Dog: 92%; Pig: 92%; Bovine: 85%; Rat: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.