HCP1 (SLC46A1) Rabbit Polyclonal Antibody
CAT#: TA334591
Rabbit Polyclonal Anti-SLC46A1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
Cited in 1 publication. |
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SLC46A1 antibody: synthetic peptide directed towards the N terminal of human SLC46A1. Synthetic peptide located within the following region: MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 50 kDa |
Gene Name | solute carrier family 46 member 1 |
Database Link | |
Background | This gene encodes a transmembrane proton-coupled folate transporter protein that facilitates the movement of folate and antifolate substrates across cell membranes, optimally in acidic pH environments. This protein is also expressed in the brain and choroid plexus where it transports folates into the central nervous system. This protein further functions as a heme transporter in duodenal enterocytes, and potentially in other tissues like liver and kidney. Its localization to the apical membrane or cytoplasm of intestinal cells is modulated by dietary iron levels. Mutations in this gene are associated with autosomal recessive hereditary folate malabsorption disease. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2013] |
Synonyms | G21; HCP1; PCFT |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93% |
Reference Data | |
Protein Families | Transmembrane |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Targeted Delivery of Nanoparticulate Cytochrome C into Glioma Cells Through the Proton-Coupled Folate Transporter
,Kucheryavykh, YV;Davila, J;Ortiz-Rivera, J;Inyushin, M;Almodovar, L;Mayol, M;Morales-Cruz, M;Cruz-Montañez, A;Barcelo-Bovea, V;Griebenow, K;Kucheryavykh, LY;,
Biomolecules
,PubMed ID 31003476
[SLC46A1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |