PTGR1 Rabbit Polyclonal Antibody
CAT#: TA334445
Rabbit Polyclonal Anti-PTGR1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PTGR1 antibody: synthetic peptide directed towards the N terminal of human PTGR1. Synthetic peptide located within the following region: VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 36 kDa |
Gene Name | prostaglandin reductase 1 |
Database Link | |
Background | PTGR1 functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. It has no activity towards PGE1, PGE2 and PGE2-alpha. PTGR1 catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4. |
Synonyms | LTB4DH; PGR1; ZADH3 |
Note | Immunogen Sequence Homology: Human: 93%; Bovine: 93%; Pig: 83%; Horse: 83%; Rabbit: 83%; Guinea pig: 83%; Rat: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |