PTGR1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PTGR1 antibody: synthetic peptide directed towards the N terminal of human PTGR1. Synthetic peptide located within the following region: VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	prostaglandin reductase 1
Database Link	NP_036344 Entrez Gene 22949 Human UniProt ID Q14914
Background	PTGR1 functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. It has no activity towards PGE1, PGE2 and PGE2-alpha. PTGR1 catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.
Synonyms	LTB4DH; PGR1; ZADH3
Note	Immunogen Sequence Homology: Human: 93%; Bovine: 93%; Pig: 83%; Horse: 83%; Rabbit: 83%; Guinea pig: 83%; Rat: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.