PDZD6 (INTU) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-INTU antibody is: synthetic peptide directed towards the C-terminal region of Human INTU. Synthetic peptide located within the following region: TLEEVAQLSGSIHPQLIKNFHQCCLSIRAVFQQTLVEEKKKGLNSGDHSD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	104 kDa
Gene Name	inturned planar cell polarity protein
Database Link	NP_056508 Entrez Gene 27152 Human UniProt ID Q9ULD6
Background	INTU plays a key role in ciliogenesis and embryonic development. INTU is a regulator of cilia formation by controlling the organization of the apical actin cytoskeleton and the positioning of the basal bodies at the apical cell surface, which in turn is essential for the normal orientation of elongating ciliary microtubules. It plays a key role in definition of cell polarity via its role in ciliogenesis but not via conversion extension and has an indirect effect on hedgehog signaling.
Synonyms	INT; PDZD6; PDZK6
Note	Immunogen Sequence Homology: Human: 100%; Dog: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.