ZIC5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZIC5 antibody: synthetic peptide directed towards the N terminal of human ZIC5. Synthetic peptide located within the following region: MEPPLSKRNPPALRLADLATAQVQPLQNMTGFPALAGPPAHSQLRAAVAH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	66 kDa
Gene Name	Zic family member 5
Database Link	NP_149123 Entrez Gene 85416 Human UniProt ID Q96T25
Background	ZIon Channel5 is a member of the ZIon Channel family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to a gene encoding zinc finger protein of the cerebellum 2, a related family member on chromosome 13. This gene encodes a protein of unknown function.
Synonyms	Drosophila); OTTHUMP00000040732; Zic family member 5 (odd-paired homolog; zinc family member 5 protein; zinc finger protein of the cerebellum 5
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 92%; Guinea pig: 86%; Zebrafish: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.