NRAMP1 (SLC11A1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC11A1 Antibody is: synthetic peptide directed towards the middle region of Human SLC11A1. Synthetic peptide located within the following region: GYEYVVARPEQGALLRGLFLPSCPGCGHPELLQAVGIVGAIIMPHNIYLH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	solute carrier family 11 member 1
Database Link	NP_000569 Entrez Gene 6556 Human UniProt ID P49279
Background	SLC11A1 is a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Macrophage-specific membrane transport function. It controls natural resistance to infection with intracellular parasites. Pathogen resistance involves sequestration of Fe2+ and Mn2+, cofactors of both prokaryotic and eukaryotic catalases and superoxide dismutases, not only to protect the macrophage against its own generation of reactive oxygen species, but to deny the cations to the pathogen for synthesis of its protective enzymes.
Synonyms	LSH; NRAMP; NRAMP1
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%; Goat: 86%; Horse: 86%; Sheep: 86%; Bovine: 86%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Lysosome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.