ZNF182 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF21 Antibody: synthetic peptide directed towards the middle region of human ZNF21. Synthetic peptide located within the following region: RTHTGEKPYACTECGKAFREKSTFTVHQRTHTGEKPYKCTECGKAFTQKS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	72 kDa
Gene Name	zinc finger protein 182
Database Link	NP_001007089 Entrez Gene 7569 Human UniProt ID P17025
Background	Located on chromosome X, ZNF21 encodes a zinc finger protein 21.
Synonyms	HHZ150; KOX14; Zfp182; ZNF21
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.