SLC10A5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC10A5 Antibody: synthetic peptide directed towards the C terminal of human SLC10A5. Synthetic peptide located within the following region: GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	solute carrier family 10 member 5
Database Link	NP_001010893 Entrez Gene 347051 Human UniProt ID Q5PT55
Background	SLC10A5 is a new member of Solute Carrier Family 10 (SLC10) and the function remains unknown.
Synonyms	P5
Note	Immunogen sequence homology: Human: 100%; Rat: 91%; Horse: 86%; Pig: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.