CCDC159 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CCDC159 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC159. Synthetic peptide located within the following region: CRKILTKMKQQGHETAACPETEEIPQGASGCWKDDLQKELSDIWSAVHVL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	coiled-coil domain containing 159
Database Link	NP_001073972 Entrez Gene 126075 Human UniProt ID P0C7I6
Background	The function of this protein remains unknown.
Synonyms	FLJ45351; FLJ79238
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.