PPP1R1C Rabbit Polyclonal Antibody

CAT#: TA334115

Rabbit Polyclonal Anti-PPP1R1C Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-PPP1R1C Antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1R1C. Synthetic peptide located within the following region: GELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 11 kDa
Gene Name protein phosphatase 1 regulatory inhibitor subunit 1C
Background Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit and regulatory subunits that determine the subcellular localization of PP1 or regulate its function. PPP1R1C belongs to a group of PP1 inhibitory subunits that are themselves regulated by phosphorylation.
Synonyms IPP5
Note Immunogen sequence homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 85%
Reference Data
Protein Families Druggable Genome, Phosphatase
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...