Gpx7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Gpx7 Antibody is: synthetic peptide directed towards the C-terminal region of Rat Gpx7. Synthetic peptide located within the following region: RTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	glutathione peroxidase 7
Database Link	NP_001100143 Entrez Gene 298376 Rat
Background	The function of this protein remains unknown.
Synonyms	CL683; GPx-7; GPX6; GSHPx-7; NPGPx
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.