SIRPB2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SIRPB2 Antibody is: synthetic peptide directed towards the middle region of Human SIRPB2. Synthetic peptide located within the following region: GGISHPKETAVQASNNDFSILLQNVSSEDAGTYYCVKFQRKPNRQYLSGQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	signal regulatory protein beta 2
Database Link	NP_001128308 Entrez Gene 284759 Human UniProt ID Q5JXA9
Background	The function of this protein remains unknown.
Synonyms	dJ776F14.2; PTPN1L; PTPNS1L3
Note	Immunogen sequence homology: Human: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Dog: 86%; Rat: 86%; Bovine: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.