IYD Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-IYD Antibody is: synthetic peptide directed towards the N-terminal region of Human IYD. Synthetic peptide located within the following region: NADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	iodotyrosine deiodinase
Database Link	NP_001158167 Entrez Gene 389434 Human UniProt ID Q6PHW0
Background	This gene encodes an enzyme that catalyzes the oxidative NADPH-dependent deiodination of mono- and diiodotyrosine, which are the halogenated byproducts of thyroid hormone production. The N-terminus of the protein functions as a membrane anchor. Mutations in this gene cause congenital hypothyroidism due to dyshormonogenesis type 4, which is also referred to as deiodinase deficiency, or iodotyrosine dehalogenase deficiency, or thyroid hormonogenesis type 4.
Synonyms	C6orf71; DEHAL1; IYD-1; TDH4
Note	Immunogen sequence homology: Human: 100%; Rat: 86%; Dog: 79%; Rabbit: 79%; Bovine: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.