MCT2 (SLC16A7) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC16A7 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC16A7. Synthetic peptide located within the following region: LAGKLVDLTGEYKYMYMSCGAIVVAASVWLLIGNAINYRLLAKERKEENA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	solute carrier family 16 member 7
Database Link	NP_001257551 Entrez Gene 9194 Human UniProt ID O60669
Background	The function of this protein remains unknown.
Synonyms	MCT2
Note	Immunogen sequence homology: Human: 100%; Dog: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 85%; Pig: 79%; Rat: 79%; Zebrafish: 79%; Guinea pig: 75%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.