SLC37A4 Rabbit Polyclonal Antibody

CAT#: TA334060

Rabbit Polyclonal Anti-SLC37A4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Transient overexpression lysate of solute carrier family 37 (glucose-6-phosphate transporter), member 4 (SLC37A4), transcript variant 1
    • 100 ug

CNY 3,080.00


Transient overexpression lysate of solute carrier family 37 (glucose-6-phosphate transporter), member 4 (SLC37A4), transcript variant 4
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-SLC37A4 Antibody: synthetic peptide directed towards the middle region of human SLC37A4. Synthetic peptide located within the following region: VSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 46 kDa
Gene Name solute carrier family 37 member 4
Background SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.
Synonyms G6PT1; G6PT2; G6PT3; GSD1b; GSD1c; GSD1d; PRO0685; TRG-19; TRG19
Note Immunogen sequence homology: Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...