SLC34A1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Slc34a1 Antibody is: synthetic peptide directed towards the N-terminal region of RAT Slc34a1. Synthetic peptide located within the following region: YVPSPQVLHRIPGTTTYAISSLSPVALTEHSCPYGEVLECHDPLPAKLAQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	solute carrier family 34 member 1
Database Link	NP_003043 Entrez Gene 25548 Rat UniProt ID Q06495
Background	The function of this protein remains unknown.
Synonyms	FRTS2; NAPI-3; NPHLOP1; NPT2; NPTIIa; SLC11; SLC17A2
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Horse: 92%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.