TEAD3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TEAD3 Antibody: synthetic peptide directed towards the middle region of human TEAD3. Synthetic peptide located within the following region: GLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTIS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	TEA domain transcription factor 3
Database Link	NP_003205 Entrez Gene 7005 Human UniProt ID Q99594
Background	TEAD3 is a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer.This gene encodes a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer. The protein is encoded through the use of a non-AUG (ATA) translation initiation codon.
Synonyms	DTEF-1; ETFR-1; TEAD-3; TEAD5; TEF-5; TEF5
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.