CLEC3A Rabbit Polyclonal Antibody
CAT#: TA333932
Rabbit Polyclonal Anti-CLEC3A Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-CLEC3A Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC3A. Synthetic peptide located within the following region: GKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 22 kDa |
Gene Name | C-type lectin domain family 3 member A |
Database Link | |
Background | CLEC3A promotes cell adhesion to laminin-332 and fibronectin. |
Synonyms | CLECSF1 |
Note | Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86%; Zebrafish: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |