Usp12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Usp12 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Usp12. Synthetic peptide located within the following region: HSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIAD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	ubiquitin specific peptidase 12
Database Link	NP_035799 Entrez Gene 22217 Mouse UniProt ID Q9D9M2
Background	Usp12 is a deubiquitinating enzyme. It has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. It is not involved in deubiquitination of monoubiquitinated FANCD2.
Synonyms	UBH1; USP12L1
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.