CLUAP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CLUAP1 Antibody: synthetic peptide directed towards the C terminal of human CLUAP1. Synthetic peptide located within the following region: RIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	clusterin associated protein 1
Database Link	NP_055856 Entrez Gene 23059 Human UniProt ID Q96AJ1
Background	CLUAP1 may play a role in cell proliferation or apoptosis.
Synonyms	CFAP22; FAP22; IFT38
Note	Immunogen sequence homology: Human: 100%; Zebrafish: 93%; Rat: 92%; Mouse: 92%; Yeast: 92%; Bovine: 86%; Goat: 85%; Pig: 79%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.