TRPC4AP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TRPC4AP Antibody: synthetic peptide directed towards the middle region of human TRPC4AP. Synthetic peptide located within the following region: GASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	91 kDa
Gene Name	transient receptor potential cation channel subfamily C member 4 associated protein
Database Link	NP_056453 Entrez Gene 26133 Human UniProt ID Q8TEL6
Background	TRPC4AP may participate in the activation of NFKB1 in response to ligation of TNFRSF1A. TRPC4AP could serve as a scaffolding protein to link TNFRSF1A to the IKK signalosome.
Synonyms	C20orf188; PPP1R158; TRRP4AP; TRUSS
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 86%; Rabbit: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.