C20orf20 (MRGBP) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C20ORF20 Antibody: synthetic peptide directed towards the middle region of human C20ORF20. Synthetic peptide located within the following region: LSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	MRG/MORF4L binding protein
Database Link	NP_060740 Entrez Gene 55257 Human UniProt ID Q9NV56
Background	C20orf20 belongs to the EAF7 family. It is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.
Synonyms	C20orf20; Eaf7; MRG15BP; URCC4
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.