ZNF447 (ZSCAN18) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF447 Antibody: synthetic peptide directed towards the N terminal of human ZNF447. Synthetic peptide located within the following region: PADLEFSRLRFREFVYQEAAGPHQTLARLHELCRQWLMPEARSKEQMLEL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	zinc finger and SCAN domain containing 18
Database Link	NP_076415 Entrez Gene 65982 Human UniProt ID Q8TBC5
Background	ZNF447 contains 1 SCAN box domain and 2 C2H2-type zinc fingers. It belongs to the kruppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Synonyms	ZNF447
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.