JMJD5 (KDM8) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FLJ13798 Antibody: synthetic peptide directed towards the C terminal of human FLJ13798. Synthetic peptide located within the following region: YPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	lysine demethylase 8
Database Link	NP_079049 Entrez Gene 79831 Human UniProt ID Q8N371
Background	The FLJ13798 gene, located on chromosome 16, encodes a hypothetical protein with unknown function.
Synonyms	JMJD5
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Rabbit: 92%; Guinea pig: 92%; Zebrafish: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.