GNGT2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GNGT2 Antibody: synthetic peptide directed towards the middle region of human GNGT2. Synthetic peptide located within the following region: KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	8 kDa
Gene Name	G protein subunit gamma transducin 2
Database Link	NP_113686 Entrez Gene 2793 Human UniProt ID O14610
Background	Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. GNGT2 is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones.Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. There is evidence for use of multiple polyadenylation sites by this gene.
Synonyms	G-GAMMA-8; G-GAMMA-C; GNG8; GNG9; GNGT8
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Bovine: 93%; Rabbit: 92%; Horse: 86%; Mouse: 86%; Rat: 85%; Pig: 77%; Sheep: 77%; Guinea pig: 77%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Chemokine signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.