ABRAXAS2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM175B Antibody: synthetic peptide directed towards the middle region of human FAM175B. Synthetic peptide located within the following region: FAAEGRSTLGDAEASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	family with sequence similarity 175 member B
Database Link	NP_115558 Entrez Gene 23172 Human UniProt ID Q15018
Background	FAM175B is the component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin. It may act as a central scaffold protein that assembles the various components of the BRISC complex.
Synonyms	ABRO1; KIAA0157
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.