C14orf142 (GON7) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C14orf142 Antibody is: synthetic peptide directed towards the C-terminal region of Human C14orf142. Synthetic peptide located within the following region: LVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	11 kDa
Gene Name	chromosome 14 open reading frame 142
Database Link	NP_115879 Entrez Gene 84520 Human UniProt ID Q9BXV9
Background	The function of this protein remains unknown.
Synonyms	PNAS-127
Note	Immunogen sequence homology: Human: 100%; Rat: 91%; Mouse: 91%; Dog: 86%; Horse: 86%; Bovine: 86%; Pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.