SLC2A13 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC2A13 Antibody: synthetic peptide directed towards the middle region of human SLC2A13. Synthetic peptide located within the following region: GSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNATCTRYSYCNEC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	68 kDa
Gene Name	solute carrier family 2 member 13
Database Link	NP_443117 Entrez Gene 114134 Human UniProt ID Q96QE2
Background	SLC2A13 is an H (+)-myo-inositol cotransporter. It can also transport related stereoisomers.
Synonyms	HMIT
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Horse: 93%; Pig: 86%; Guinea pig: 86%; Rat: 79%; Bovine: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.