CCDC34 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CCDC34 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC34. Synthetic peptide located within the following region: IGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEKHKEWVQKK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	coiled-coil domain containing 34
Database Link	NP_542385 Entrez Gene 91057 Human UniProt ID Q96HJ3
Background	The function of this protein remains unknown.
Synonyms	L15; NY-REN-41; RAMA3
Note	Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 86%; Yeast: 85%; Zebrafish: 85%; Bovine: 79%; Guinea pig: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.