SLC22A12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC22A12 Antibody: synthetic peptide directed towards the N terminal of human SLC22A12. Synthetic peptide located within the following region: SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	solute carrier family 22 member 12
Database Link	NP_653186 Entrez Gene 116085 Human UniProt ID Q96S37
Background	SLC22A12 is required for efficient urate re-absorption in the kidney. SLC22A12 regulates blood urate levels. SLC22A12 mediates saturable urate uptake by facilitating the exchange of urate against organic anions.The protein encoded by this gene is a urate transporter and urate-anion exchanger which regulates the level of urate in the blood. This protein is an integral membrane protein primarily found in kidney. Two transcript variants encoding different isoforms have been found for this gene.
Synonyms	OAT4L; RST; URAT1
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.