HYLS1 Rabbit Polyclonal Antibody
CAT#: TA333506
Rabbit Polyclonal Anti-HYLS1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-HYLS1 Antibody: synthetic peptide directed towards the middle region of human HYLS1. Synthetic peptide located within the following region: YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 34 kDa |
Gene Name | HYLS1, centriolar and ciliogenesis associated |
Database Link | |
Background | This protein is a protein localized to the cytoplasm. Mutations in this protein are associated with hydrolethalus syndrome. |
Synonyms | HLS |
Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Bovine: 93%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Horse: 86%; Mouse: 86%; Rabbit: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |