GOLM2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CASC4 Antibody is: synthetic peptide directed towards the middle region of Human CASC4. Synthetic peptide located within the following region: FQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	cancer susceptibility candidate 4
Database Link	NP_816929 Entrez Gene 113201 Human UniProt ID Q6P4E1
Background	The increased expression level of this gene is associated with HER-2/neu proto-oncogene overexpression. Amplification and resulting overexpression of this proto-oncogene are found in approximately 30% of human breast and 20% of human ovarian cancers. Alternatively spliced variants encoding different isoforms have been identified for this gene.
Synonyms	H63
Note	Immunogen sequence homology: Human: 100%; Mouse: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.