VSIG1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-VSIG1 Antibody: synthetic peptide directed towards the N terminal of human VSIG1. Synthetic peptide located within the following region: SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	V-set and immunoglobulin domain containing 1
Database Link	NP_872413 Entrez Gene 340547 Human UniProt ID Q86XK7
Background	The specific function of this protein remains unknown.
Synonyms	1700062D20Rik; dJ889N15.1; GPA34
Note	Immunogen sequence homology: Human: 100%; Pig: 86%; Horse: 79%; Bovine: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.