CD32 (FCGR2C) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FCGR2C Antibody is: synthetic peptide directed towards the N-terminal region of Human FCGR2C. Synthetic peptide located within the following region: GTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	Fc fragment of IgG receptor IIc (gene/pseudogene)
Database Link	NP_963857 Entrez Gene 9103 Human UniProt ID P31995
Background	This gene encodes one of three members of a family of low-affinity immunoglobulin gamma Fc receptors found on the surface of many immune response cells. The encoded protein is a transmembrane glycoprotein and may be involved in phagocytosis and clearing of immune complexes. An allelic polymorphism in this gene results in both coding and non-coding variants.
Synonyms	CD32; CD32C; CDW32; FCG2; FCRIIC; IGFR2
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Horse: 91%; Rabbit: 91%; Bovine: 90%
Reference Data
Protein Families	ES Cell Differentiation/IPS, Transmembrane
Protein Pathways	Fc gamma R-mediated phagocytosis, Systemic lupus erythematosus

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.