OR13J1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-OR13J1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR13J1. Synthetic peptide located within the following region: ILRVPSAARCCKAFSTCLAHLAVVLLFYGTIIFMYLKPKSKEAHISDEVF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	olfactory receptor family 13 subfamily J member 1
Database Link	NP_001004487 Entrez Gene 392309 Human UniProt ID Q8NGT2
Background	OR13J1 is a potential odorant receptor.
Synonyms	OR9-2
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 79%; Rabbit: 79%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Olfactory transduction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.