ACSM2A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ACSM2A Antibody is: synthetic peptide directed towards the C-terminal region of Human ACSM2A. Synthetic peptide located within the following region: SYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETGLTCMVSK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	acyl-CoA synthetase medium-chain family member 2A
Database Link	NP_001010845 Entrez Gene 123876 Human UniProt ID Q08AH3
Background	ACSM2A has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). It acts on acids from C4 to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro).
Synonyms	A-923A4.1; ACSM2
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Rabbit: 93%; Rat: 90%; Pig: 86%; Mouse: 86%; Guinea pig: 86%; Horse: 85%; Bovine: 85%; Zebrafish: 85%
Reference Data
Protein Pathways	Butanoate metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.