C1orf69 (IBA57) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-IBA57 Antibody is: synthetic peptide directed towards the N-terminal region of Human IBA57. Synthetic peptide located within the following region: ILYGLQEHSEVSGFLLECDSSVQGALQKHLALYRIRRKVTVEPHPELRVW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	IBA57 homolog, iron-sulfur cluster assembly
Database Link	NP_001010867 Entrez Gene 200205 Human UniProt ID Q5T440
Background	IBA57 is required for normal heme biosynthesis.
Synonyms	C1orf69; MMDS3; SPG74
Note	Immunogen sequence homology: Human: 100%; Mouse: 93%; Dog: 79%; Pig: 79%; Rat: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.