CT45A1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CT45A1 Antibody is: synthetic peptide directed towards the N-terminal region of Human CT45A1. Synthetic peptide located within the following region: VFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	cancer/testis antigen family 45, member A1
Database Link	NP_001017417 Entrez Gene 541466 Human UniProt ID Q5HYN5
Background	The function of this protein remains unknown.
Synonyms	CT45; CT45-1; CT45.1
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.