FRMPD2 Rabbit Polyclonal Antibody
CAT#: TA332255
Rabbit Polyclonal Anti-FRMPD2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-FRMPD2 Antibody is: synthetic peptide directed towards the N-terminal region of Human FRMPD2. Synthetic peptide located within the following region: LLQGQSEDEQPDASQMHVYSLGMTLYWSAGFHVPPHQPLQLCEPLHSILL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 43 kDa |
Gene Name | FERM and PDZ domain containing 2 |
Database Link | |
Background | This gene encodes a peripheral membrane protein and is located in a region of chromosome 10q that contains a segmental duplication. This copy of the gene is full-length and is in the telomeric duplicated region. Two other more centromerically proximal copies of the gene are partial and may represent pseudogenes. This full-length gene appears to function in the establishment and maintenance of cell polarization. The protein is recruited to cell-cell junctions in an E-cadherin-dependent manner, and is selectively localized at the basolateral membrane in polarized epithelial cells. Alternative splicing results in multiple transcript variants. |
Synonyms | PDZD5C; PDZK4; PDZK5C |
Note | Immunogen sequence homology: Human: 100%; Pig: 86%; Bovine: 79%; Guinea pig: 79%; Horse: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |