ZNF226 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF226 Antibody: synthetic peptide directed towards the N terminal of human ZNF226. Synthetic peptide located within the following region: ATRRQGNLGEKNQSKLITVQDRESEEELSCWQIWQQIANDLTRCQDSMIN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	88 kDa
Gene Name	zinc finger protein 226
Database Link	NP_001027545 Entrez Gene 7769 Human UniProt ID Q9NYT6
Background	ZNF226 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 19 C2H2-type zinc fingers and 1 KRAB domain. ZNF226 may be involved in transcriptional regulation.
Synonyms	Kruppel-associated box protein; zinc finger protein 226
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.