ATAD3C Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ATAD3C Antibody is: synthetic peptide directed towards the N-terminal region of Human ATAD3C. Synthetic peptide located within the following region: QMQEQTLQLEQQSKLKQLVNEDLRKQEESVQKHHQTFLESIRAAGTLFGE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	ATPase family, AAA domain containing 3C
Database Link	NP_001034300 Entrez Gene 219293 Human UniProt ID Q5T2N8
Background	The function of this protein remains unknown.
Synonyms	FLJ34599; FLJ37183
Note	Immunogen sequence homology: Human: 100%; Dog: 85%; Pig: 85%; Rat: 85%; Mouse: 85%; Bovine: 85%; Zebrafish: 85%; Guinea pig: 85%; Horse: 75%; Rabbit: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.