Polyserase3 (PRSS53) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PRSS53 Antibody is: synthetic peptide directed towards the N-terminal region of Human PRSS53. Synthetic peptide located within the following region: GATVLMEGLQAAQRACGQRGPGPPKPQEGNTVPGEWPWQASVRRQGAHIC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	protease, serine 53
Database Link	NP_001034592 Entrez Gene 339105 Human UniProt ID Q2L4Q9
Background	PRSS53 in vitro can degrade the fibrinogen alpha chain of as well as pro-urokinase-type plasminogen activator.
Synonyms	POL3S; UNQ308
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 92%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.