PTAR1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PTAR1 Antibody is: synthetic peptide directed towards the C-terminal region of Human PTAR1. Synthetic peptide located within the following region: LISQTVIDSSVMEQNPLRSEPALVPPKDEEAAVSTEEPRINLPHLLEEEV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	protein prenyltransferase alpha subunit repeat containing 1
Database Link	NP_001093136 Entrez Gene 375743 Human UniProt ID Q7Z6K3
Background	The function of this protein remains unknown.
Synonyms	FLJ45604
Note	Immunogen sequence homology: Human: 100%; Horse: 92%; Rat: 83%; Mouse: 83%; Rabbit: 83%; Dog: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.